PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC24994_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 130aa    MW: 14434.5 Da    PI: 10.0621
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC24994_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3952110260
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                  ++k+++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k 
  RrC24994_p1  52 PDKIIACPRCKSMETKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKSKP 110
                  68999***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2951109IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3254109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.04356110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MATQNSQGIK LFGKTIAFNV NITQTIKSEE DKPPSDPVAR SSSSDPTVEK RPDKIIACPR  60
CKSMETKFCY FNNYNANQPR HFCKSCHRYW TAGGALRNVP VGAGRRKSKP LGRVVIGMLG  120
DGNEVHHVEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0023413e-78AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence.
GenBankAK2213083e-78AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19.
GenBankBT0104963e-78BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds.
GenBankCP0026853e-78CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635531.15e-82PREDICTED: cyclic dof factor 4-like
RefseqXP_013719282.15e-82PREDICTED: cyclic dof factor 4-like
SwissprotO229671e-72CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A078HH544e-82A0A078HH54_BRANA; BnaA04g19980D protein
TrEMBLA0A0D3C4235e-82A0A0D3C423_BRAOL; Uncharacterized protein
STRINGBra021895.1-P4e-80(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.18e-74Dof family protein